Shawn Lewenza; Jennifer L. Gardy; Fiona S.L. Brinkman; Robert E.W. Hancock

Table 3.

Proteins predicted to have potential TAT signal peptides

PAID	Gene	Protein	Sequence^c
a. Proteins predicted to contain a TAT signal peptide
PA0144^a		hypothetical protein	MSRSNGSSSRRTFLR
PA1601^a		probable aldehyde dehydrogenase	MSLANPSRRGFLK
PA2065^a	pcoA	copper resistance protein A precursor	MHRTSRRTFVK
PA2328^b		hypothetical protein	MCLDDPTHSRRDILK
PA2394^a	pvdN	PvdN	MNDRRTFLK
PA3319^a	plcN	non-hemolytic phospholipase C precursor	MISKSRRSFIR
PA3493^b		conserved hypothetical protein	MDAATRRSMLR
PA3713^b		hypothetical protein	MTISRRDFLN
PA4160	fepD	ferric enterobactin transport protein FepD	MQASPMRRRRLR
PA4431^b		probable iron-sulfur protein	MSNDGVNAGRRRFLV
PA4621^a		probable oxidoreductase	MSNRDISRRAFLO
PA4650		hypothetical protein	MPMSSRRLFLS
PA4712		hypothetical protein	MRRFSLR
PA4812^a	fdnG	formate dehydrogenase-O, major subunit	MDMNRROFFK
PA4858^b		conserved hypothetical protein	MKRRSLLK
b. Additional putative TAT substrates
PA0205^b		probable permease of ABC transporter	MHPIPSPGAALQRROALR
PA1880^a		probable oxidoreductase	MNSKIDLSNALPGSRRGFLK
PA2195	hcnC	hydrogen cyanide synthase HcnC	MNRTYDIVIAGGGVIGASCAYQLSRRGNLR
PA2378^a		probable aldehyde dehydrogenase	MKRSYPDDLVIGNLSRRGFLK
PA3377		conserved hypothetical protein	MSLSPQASAAPEQGYNFAYLDEQTKRMIRRGLLK
PA3392^a	nosZ	nitrous-oxide reductase precursor	MSDDTKSPHEETHGLNRRGFLG
PA3750		hypothetical protein	MRRLATLAWWAAALPLLPLAVPLAIRTRRRALR
PA3825^b		hypothetical protein	MPIPVKRARRKALR
PA4608		hypothetical protein	MSDQHDERRRFHR
PA4882		hypothetical protein	MKGPEKKRAKIAIDPSSERQMVDLQRRLLLR
PA5280	sss	site-specific recombinase Sss	MRADLDAFLEHLRSERQVSAHTLDGYRRDLLK
PA5354	glcE	glycolate oxidase subunit GlcE	MSQPYFDPDAGADHAGALLERVRDALARRAPLR

↵a Reported in Ochsner et al. (2002).
↵b Reported in Dilks et al. (2003).
↵c The bold and underlined sequences identify the putative TAT motif as described in Figure 1C.

Genome-wide identification of Pseudomonas aeruginosa exported proteins using a consensus computational strategy combined with a laboratory-based PhoA fusion screen

This Article

Preprint Server

Current Issue

In This Issue