E. coli Selection of Human Genes Encoding Secreted and Membrane Proteins Based on cDNA Fusions to a Leaderless β-Lactamase Reporter

Table 2.

Positive Clones from the 293 Cell Line Assay Representing Previously Identified Proteins


No.

NCBI accession

Protein

Absorbance 486 nm

Localization

Putative signal
Cell surface or secreted proteins
1 806752 Na,K-ATPase alpha-1 subunit 0.12 cell surface, multiTM, prediction MLLWIGAILCFLAYSIQA
2 7861733 low density liproprotein receptor related 0.12 cell surface, 1TM, prediction n.d.
3 4151807 membrane-associated guanylate kinase-interacting protein 2 0.13 cell surface, prediction n.d.
4 66344454 betaglycan, TGF-receptor type III 0.13 cell surface or secreted, prediction MTSHYVIAIFALMSFCLA
5 699577 lumican (keratan sulfate proteoglycan 0.13 secreted, experimental MSLSAFTLFLALIGGTSG
6 2529742 Rb-8 neural cell adhesion molecule 0.13 cell surface, 1TM, prediction MSLLLSFYLLGLLVRSGQA
7 180948 carboxylesterase 0.13 secreted, experimental MWLRAFILATLSASAAWA
8 5923891 cyclophilin-related protein 0.13 cell surface, 1 TM, experimental n.d.
9 9664928 frizzled-3 0.13 cell surface, multiTM, prediction MAMTWIVFSLWPLTVFMGHIGG
10 34618 MGP precursor (AA-19 to 84) 0.14 secreted, experimental MKSLILLAILAALAVVTLC
11 6560599 small solute channel 1 0.14 cell surface, multiTM, experimental n.d.
12 758063 gastric lipase precursor 0.14 secreted, experimental MWLLLTMASLISVLGTTHG
13 179720 complement protein C8 beta subunit 0.15 secreted, prediction MKNSRTWAWRAPVELFLLCAALGCLS
14 3329376 E25 protein 0.15 cell surface, 1TM, prediction MLTLLGLSFILAGLIVGGAC
15 6165625 procollagen C-terminal proteinase 0.16 secreted, prediction MRGANAWAPLCLLLAAATQLSRQQS
16 506404 cadherin-11 0.16 cell surface, 1TM, experimental MKENYCLQAALVCLGMLCHSHA
17 2160714 carboxypeptidase Z precursor 0.16 secreted, experimental MPPPPLLLLLTVLVVAAARP
18 2213913 neuronal calcium channel alpha 1A subunit 0.16 cell surface, multiTM, experimental MKSIISLLFLLFLFIVVFALLG
19 182280 EVI2 protein 0.23 cell surface, 1TM, prediction MEHTGHYLHLAFLMTTVFSLSPGTKA
20 4336325 small membrane protein 1 0.25 cell surface, multiTM, prediction n.d.
21 3982775 insulin receptor binding protein GRB-IR 0.26 cell surface, mitochondrion and cytoplasm, experimental n.d.
22 6707925 T calcium channel alpha1I subunit 0.29 cell surface, multiTM, experimental n.d.
23 414928 G protein-coupled receptor 0.33 cell surface, multiTM, experimental MTDKYRLHLSVADLLFVITLPFWAVDA
24 31442 integrin beta 1 subunit precursor 0.34 cell surface, 1TM, experimental n.d.
25 1663517 membrane glycoprotein M6 0.34 cell surface, multiTM, prediction MLAWLGVTAFTSLPVYMLA
26 11559216 MS4A6 0.34 cell surface, multiTM, prediction MMVLSLGIILASASFSPNFTQVTS
27 6434904 tetraspanin TM4-C 0.35 cell surface, multiTM, prediction MMILFNLLIFLCGAALLAVGIWV
28 6642960 glycoprotein-associated amino acid 0.39 cell surface, multiTM, experimental MIHVKRCTPIPALLFTCISTLLMLVTS
29 386790 cell surface glycoprotein 0.39 cell surface, 1TM, experimental MRMATPLLMQALPMGALP
30 5457049 protocadherin beta 7 0.46 cell surface, 1TM, prediction MEARVERAVQKRQVLFLCVFLGMSWAGA
31 337360 receptor tyrosine kinase 0.46 cell surface, 1TM, prediction MKPATGLWVWVSLLVAAGTVQP
32 516263 adenylyl cyclase 0.49 cell surface, multiTM, prediction MLPLPLTWAILAGLGTSLLQVILQVVI
33 5042232 disintegrin-protease 0.54 cell surface, 1TM, prediction MLRGISQLPAVATMSWVLLPVLWLIVQTQA
34 9965402 twisted gastrulation protein precursor 0.56 secreted, prediction MKLHYVAVLTLAILMFLTWLPESLS
35 178250 angiogenin 0.57 secreted and nuclear, experimental MVMGLGVWLLVFVLGLGLTPPTLA
36 5457045 protocadherin beta 5 0.57 cell surface, 1TM, prediction METALAKTPQKRQVMFLAILLLLWEAGSEA
37 3006228 Zn-alpha2-glycoprotein 0.58 secreted, experimental MVPVLLSLLLLLGPAVPQ
38 3127176 sulfonylurea receptor 2B 0.62 cell surface, multiTM, experimental MNAAIPIAAVLATFVTHAYA
Intracellular proteins
39 303616 PIG-F 0.13 ER, multiTM, prediction MHKRWVYSSLLISLSFMVFSWMA
40 37265 TRAM protein 0.14 ER membrane, multiTM, experimental n.d.
41 6911590 calnexin 0.14 ER membrane, 1TM, experimental MEGKWLLCML LVLGTAIVEA
42 307311 neuroendocrine-specific protein C 0.17 ER membrane, multiTM, experimental n.d.
43 9502013 cholinephosphotransferase 1 beta 0.50 microsome and nuclear, multiTM, experimental MAPNSITLLGLAVNVVTTLVLISYC
44 6329074 UDP-N-acetylglucosaminyltransferase 0.12 golgi, 1TM typell, prediction MRLRNGTVATALAFITSFLTLS
45 496369 glucocerebrosidase 0.32 lysosomal, experimental MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQ
46 4164448 NADH:ubiquinone oxidoreductase ASHI 0.14 mitochondrion, prediction MQLFGFLAFMIFMCWVGDVYP
47 4689104 NADH-ubiquinone oxidoreductase ASHI 0.49 mitochondrion, prediction MQLFGFLAFMIFMCWVGD
48 388166 Bax alpha 0.15 cytoplasmic, nuclear and mitochondrial, experimental n.d.
49 603074 ATP:citrate lyase 0.13 cytoplasmic, experimental n.d.
50 2443338 myosin phosphatase target subunit 1 0.14 cytoplasmic, experimental n.d.
51 8671754 DAZ associated protein 1 0.15 cytoplasmic, prediction n.d.
52 1236915 cyclin G2 0.17 cytoplasmic, prediction n.d.
53 5442446 thioltransferase 0.19 cytoplasmic, prediction n.d.
54 440306 natural-killer enhancer protein 0.20 nuclear and cytoplasmic, experimental n.d.
55 2282030 Arp2 0.27 cytoplasmic, experimental n.d.
56 13591593 RING finger protein with leucine 0.51 cytoplasmic, prediction MKMSVILGIIHMLFGVSLS
57 7542723 DHHC1 protein 0.13 nuclear, cytoplasmic, prediction n.d.
58 2924760 CIRP (cold-inducible RNA-binding protein) 0.12 nuclear, prediction n.d.
59 510408 DNA primase (p58 subunit) 0.13 nuclear, prediction n.d.
60 565643 hnRNP B1 protein 0.51 nuclear, experimental n.d.
61 7239366 groucho-related protein 4 0.30 nuclear, experimental n.d.
62 521144 ELAV-like neuronal protein 1 0.40 nuclear, experimental n.d.
Localization unknown
63 5410355 insulin induced protein 2 0.17 unknown, multiTM MIRGVVLFFIGVFLALVLNLLQIQR
64 9963859 PTD019 0.19 unknown, 1TM MRAFRKNKTLGYGVPMLLLIVGGSFG
65
4929220
colon cancer-associated protein Mic1
0.44
unknown, 0TM
n.d.

This Article

  1. Genome Res. 13: 1938-1943

Preprint Server