Table 2.
Positive Clones from the 293 Cell Line Assay Representing Previously Identified Proteins
|
No. |
NCBI accession |
Protein |
Absorbance 486 nm |
Localization |
Putative signal |
|||||
|---|---|---|---|---|---|---|---|---|---|---|
| Cell surface or secreted proteins | ||||||||||
| 1 | 806752 | Na,K-ATPase alpha-1 subunit | 0.12 | cell surface, multiTM, prediction | MLLWIGAILCFLAYSIQA | |||||
| 2 | 7861733 | low density liproprotein receptor related | 0.12 | cell surface, 1TM, prediction | n.d. | |||||
| 3 | 4151807 | membrane-associated guanylate kinase-interacting protein 2 | 0.13 | cell surface, prediction | n.d. | |||||
| 4 | 66344454 | betaglycan, TGF-receptor type III | 0.13 | cell surface or secreted, prediction | MTSHYVIAIFALMSFCLA | |||||
| 5 | 699577 | lumican (keratan sulfate proteoglycan | 0.13 | secreted, experimental | MSLSAFTLFLALIGGTSG | |||||
| 6 | 2529742 | Rb-8 neural cell adhesion molecule | 0.13 | cell surface, 1TM, prediction | MSLLLSFYLLGLLVRSGQA | |||||
| 7 | 180948 | carboxylesterase | 0.13 | secreted, experimental | MWLRAFILATLSASAAWA | |||||
| 8 | 5923891 | cyclophilin-related protein | 0.13 | cell surface, 1 TM, experimental | n.d. | |||||
| 9 | 9664928 | frizzled-3 | 0.13 | cell surface, multiTM, prediction | MAMTWIVFSLWPLTVFMGHIGG | |||||
| 10 | 34618 | MGP precursor (AA-19 to 84) | 0.14 | secreted, experimental | MKSLILLAILAALAVVTLC | |||||
| 11 | 6560599 | small solute channel 1 | 0.14 | cell surface, multiTM, experimental | n.d. | |||||
| 12 | 758063 | gastric lipase precursor | 0.14 | secreted, experimental | MWLLLTMASLISVLGTTHG | |||||
| 13 | 179720 | complement protein C8 beta subunit | 0.15 | secreted, prediction | MKNSRTWAWRAPVELFLLCAALGCLS | |||||
| 14 | 3329376 | E25 protein | 0.15 | cell surface, 1TM, prediction | MLTLLGLSFILAGLIVGGAC | |||||
| 15 | 6165625 | procollagen C-terminal proteinase | 0.16 | secreted, prediction | MRGANAWAPLCLLLAAATQLSRQQS | |||||
| 16 | 506404 | cadherin-11 | 0.16 | cell surface, 1TM, experimental | MKENYCLQAALVCLGMLCHSHA | |||||
| 17 | 2160714 | carboxypeptidase Z precursor | 0.16 | secreted, experimental | MPPPPLLLLLTVLVVAAARP | |||||
| 18 | 2213913 | neuronal calcium channel alpha 1A subunit | 0.16 | cell surface, multiTM, experimental | MKSIISLLFLLFLFIVVFALLG | |||||
| 19 | 182280 | EVI2 protein | 0.23 | cell surface, 1TM, prediction | MEHTGHYLHLAFLMTTVFSLSPGTKA | |||||
| 20 | 4336325 | small membrane protein 1 | 0.25 | cell surface, multiTM, prediction | n.d. | |||||
| 21 | 3982775 | insulin receptor binding protein GRB-IR | 0.26 | cell surface, mitochondrion and cytoplasm, experimental | n.d. | |||||
| 22 | 6707925 | T calcium channel alpha1I subunit | 0.29 | cell surface, multiTM, experimental | n.d. | |||||
| 23 | 414928 | G protein-coupled receptor | 0.33 | cell surface, multiTM, experimental | MTDKYRLHLSVADLLFVITLPFWAVDA | |||||
| 24 | 31442 | integrin beta 1 subunit precursor | 0.34 | cell surface, 1TM, experimental | n.d. | |||||
| 25 | 1663517 | membrane glycoprotein M6 | 0.34 | cell surface, multiTM, prediction | MLAWLGVTAFTSLPVYMLA | |||||
| 26 | 11559216 | MS4A6 | 0.34 | cell surface, multiTM, prediction | MMVLSLGIILASASFSPNFTQVTS | |||||
| 27 | 6434904 | tetraspanin TM4-C | 0.35 | cell surface, multiTM, prediction | MMILFNLLIFLCGAALLAVGIWV | |||||
| 28 | 6642960 | glycoprotein-associated amino acid | 0.39 | cell surface, multiTM, experimental | MIHVKRCTPIPALLFTCISTLLMLVTS | |||||
| 29 | 386790 | cell surface glycoprotein | 0.39 | cell surface, 1TM, experimental | MRMATPLLMQALPMGALP | |||||
| 30 | 5457049 | protocadherin beta 7 | 0.46 | cell surface, 1TM, prediction | MEARVERAVQKRQVLFLCVFLGMSWAGA | |||||
| 31 | 337360 | receptor tyrosine kinase | 0.46 | cell surface, 1TM, prediction | MKPATGLWVWVSLLVAAGTVQP | |||||
| 32 | 516263 | adenylyl cyclase | 0.49 | cell surface, multiTM, prediction | MLPLPLTWAILAGLGTSLLQVILQVVI | |||||
| 33 | 5042232 | disintegrin-protease | 0.54 | cell surface, 1TM, prediction | MLRGISQLPAVATMSWVLLPVLWLIVQTQA | |||||
| 34 | 9965402 | twisted gastrulation protein precursor | 0.56 | secreted, prediction | MKLHYVAVLTLAILMFLTWLPESLS | |||||
| 35 | 178250 | angiogenin | 0.57 | secreted and nuclear, experimental | MVMGLGVWLLVFVLGLGLTPPTLA | |||||
| 36 | 5457045 | protocadherin beta 5 | 0.57 | cell surface, 1TM, prediction | METALAKTPQKRQVMFLAILLLLWEAGSEA | |||||
| 37 | 3006228 | Zn-alpha2-glycoprotein | 0.58 | secreted, experimental | MVPVLLSLLLLLGPAVPQ | |||||
| 38 | 3127176 | sulfonylurea receptor 2B | 0.62 | cell surface, multiTM, experimental | MNAAIPIAAVLATFVTHAYA | |||||
| Intracellular proteins | ||||||||||
| 39 | 303616 | PIG-F | 0.13 | ER, multiTM, prediction | MHKRWVYSSLLISLSFMVFSWMA | |||||
| 40 | 37265 | TRAM protein | 0.14 | ER membrane, multiTM, experimental | n.d. | |||||
| 41 | 6911590 | calnexin | 0.14 | ER membrane, 1TM, experimental | MEGKWLLCML LVLGTAIVEA | |||||
| 42 | 307311 | neuroendocrine-specific protein C | 0.17 | ER membrane, multiTM, experimental | n.d. | |||||
| 43 | 9502013 | cholinephosphotransferase 1 beta | 0.50 | microsome and nuclear, multiTM, experimental | MAPNSITLLGLAVNVVTTLVLISYC | |||||
| 44 | 6329074 | UDP-N-acetylglucosaminyltransferase | 0.12 | golgi, 1TM typell, prediction | MRLRNGTVATALAFITSFLTLS | |||||
| 45 | 496369 | glucocerebrosidase | 0.32 | lysosomal, experimental | MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQ | |||||
| 46 | 4164448 | NADH:ubiquinone oxidoreductase ASHI | 0.14 | mitochondrion, prediction | MQLFGFLAFMIFMCWVGDVYP | |||||
| 47 | 4689104 | NADH-ubiquinone oxidoreductase ASHI | 0.49 | mitochondrion, prediction | MQLFGFLAFMIFMCWVGD | |||||
| 48 | 388166 | Bax alpha | 0.15 | cytoplasmic, nuclear and mitochondrial, experimental | n.d. | |||||
| 49 | 603074 | ATP:citrate lyase | 0.13 | cytoplasmic, experimental | n.d. | |||||
| 50 | 2443338 | myosin phosphatase target subunit 1 | 0.14 | cytoplasmic, experimental | n.d. | |||||
| 51 | 8671754 | DAZ associated protein 1 | 0.15 | cytoplasmic, prediction | n.d. | |||||
| 52 | 1236915 | cyclin G2 | 0.17 | cytoplasmic, prediction | n.d. | |||||
| 53 | 5442446 | thioltransferase | 0.19 | cytoplasmic, prediction | n.d. | |||||
| 54 | 440306 | natural-killer enhancer protein | 0.20 | nuclear and cytoplasmic, experimental | n.d. | |||||
| 55 | 2282030 | Arp2 | 0.27 | cytoplasmic, experimental | n.d. | |||||
| 56 | 13591593 | RING finger protein with leucine | 0.51 | cytoplasmic, prediction | MKMSVILGIIHMLFGVSLS | |||||
| 57 | 7542723 | DHHC1 protein | 0.13 | nuclear, cytoplasmic, prediction | n.d. | |||||
| 58 | 2924760 | CIRP (cold-inducible RNA-binding protein) | 0.12 | nuclear, prediction | n.d. | |||||
| 59 | 510408 | DNA primase (p58 subunit) | 0.13 | nuclear, prediction | n.d. | |||||
| 60 | 565643 | hnRNP B1 protein | 0.51 | nuclear, experimental | n.d. | |||||
| 61 | 7239366 | groucho-related protein 4 | 0.30 | nuclear, experimental | n.d. | |||||
| 62 | 521144 | ELAV-like neuronal protein 1 | 0.40 | nuclear, experimental | n.d. | |||||
| Localization unknown | ||||||||||
| 63 | 5410355 | insulin induced protein 2 | 0.17 | unknown, multiTM | MIRGVVLFFIGVFLALVLNLLQIQR | |||||
| 64 | 9963859 | PTD019 | 0.19 | unknown, 1TM | MRAFRKNKTLGYGVPMLLLIVGGSFG | |||||
| 65
|
4929220
|
colon cancer-associated protein Mic1
|
0.44
|
unknown, 0TM
|
n.d.
|
|||||











